SCOPe 2.08: Domain d2ecla1: 2ecl A:8-81

Lineage for d2ecla1 (2ecl A:8-81)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.0: automated matches [191345] (1 protein)
   not a true family

6. Protein automated matches [190242] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189860] (17 PDB entries)

8. Domain d2ecla1: 2ecl A:8-81 [264270]
   Other proteins in same PDB: d2ecla2
   automated match to d4p5ob_
   complexed with zn

Details for d2ecla1

PDB Entry: 2ecl

PDB Description: solution structure of the ring domain of the human ring-box protein 2

PDB Compounds: (A:) RING-box protein 2

SCOPe Domain Sequences for d2ecla1:

Sequence; same for both SEQRES and ATOM records:

>d2ecla1 g.44.1.0 (A:8-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mwswdvecdtcaicrvqvmdaclrcqaenkqedcvvvwgecnhsfhnccmslwvkqnnrc
plcqqdwvvqrigk

Timeline for d2ecla1:

• d2ecla1 first appeared in SCOPe 2.05, called d2ecla_
  
• d2ecla1 appears in SCOPe 2.07