SCOP 1.73: Domain d1qa7c_: 1qa7 C:

Lineage for d1qa7c_ (1qa7 C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)

6. Protein 3C cysteine protease (picornain 3C) [50604] (3 species)

7. Species Human hepatitis A virus [TaxId:208726] [50606] (7 PDB entries)

8. Domain d1qa7c_: 1qa7 C: [26427]

Details for d1qa7c_

PDB Entry: 1qa7, 1.9 Å

PDB Description: crystal complex of the 3c proteinase from hepatitis a virus with its inhibitor and implications for the polyprotein processing in hav

PDB Compounds: (C:) hav 3c proteinase

SCOP Domain Sequences for d1qa7c_:

Sequence; same for both SEQRES and ATOM records:

>d1qa7c_ b.47.1.4 (C:) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqnid

Timeline for d1qa7c_:

• d1qa7c_ first appeared (with stable ids) in SCOP 1.55
  
• d1qa7c_ appears in SCOP 1.71
  
• d1qa7c_ appears in SCOP 1.75
  
• d1qa7c_ appears in the current release, SCOPe 2.08