Lineage for d1qa7c_ (1qa7 C:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 61132Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (2 proteins)
  6. 61137Protein 3C cysteine protease (picornain 3C) [50604] (2 species)
  7. 61138Species Human hepatitis A virus [TaxId:208726] [50606] (2 PDB entries)
  8. 61143Domain d1qa7c_: 1qa7 C: [26427]

Details for d1qa7c_

PDB Entry: 1qa7 (more details), 1.9 Å

PDB Description: crystal complex of the 3c proteinase from hepatitis a virus with its inhibitor and implications for the polyprotein processing in hav

SCOP Domain Sequences for d1qa7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qa7c_ b.47.1.4 (C:) 3C cysteine protease (picornain 3C) {Human hepatitis A virus}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgaqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqnid

SCOP Domain Coordinates for d1qa7c_:

Click to download the PDB-style file with coordinates for d1qa7c_.
(The format of our PDB-style files is described here.)

Timeline for d1qa7c_: