Lineage for d2ebka1 (2ebk A:8-128)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939466Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2939467Protein automated matches [190120] (9 species)
    not a true protein
  7. 2939474Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries)
  8. 2939519Domain d2ebka1: 2ebk A:8-128 [264269]
    Other proteins in same PDB: d2ebka2
    automated match to d2ebma_

Details for d2ebka1

PDB Entry: 2ebk (more details)

PDB Description: solution structure of the rwd domain of human rwd domain containing protein 3
PDB Compounds: (A:) RWD domain-containing protein 3

SCOPe Domain Sequences for d2ebka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebka1 d.20.1.0 (A:8-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maepvqeelsvlaaifcrphewevlsrsetdgtvfrihtkaegfmdadiplelvfhlpvn
ypsclpgisinseqltraqcvtvkeklleqaesllsepmvhelvlwiqqnlrhilsqpet
g

SCOPe Domain Coordinates for d2ebka1:

Click to download the PDB-style file with coordinates for d2ebka1.
(The format of our PDB-style files is described here.)

Timeline for d2ebka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ebka2