![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
![]() | Protein automated matches [190120] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries) |
![]() | Domain d2ebka1: 2ebk A:8-128 [264269] Other proteins in same PDB: d2ebka2 automated match to d2ebma_ |
PDB Entry: 2ebk (more details)
SCOPe Domain Sequences for d2ebka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebka1 d.20.1.0 (A:8-128) automated matches {Human (Homo sapiens) [TaxId: 9606]} maepvqeelsvlaaifcrphewevlsrsetdgtvfrihtkaegfmdadiplelvfhlpvn ypsclpgisinseqltraqcvtvkeklleqaesllsepmvhelvlwiqqnlrhilsqpet g
Timeline for d2ebka1: