Lineage for d2dvlb2 (2dvl B:222-372)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2321545Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2321679Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2321680Protein automated matches [226935] (30 species)
    not a true protein
  7. 2321917Species Thermus thermophilus [TaxId:300852] [267776] (1 PDB entry)
  8. 2321919Domain d2dvlb2: 2dvl B:222-372 [264264]
    Other proteins in same PDB: d2dvla1, d2dvlb1
    automated match to d4l1fa2
    complexed with fad

Details for d2dvlb2

PDB Entry: 2dvl (more details), 2.5 Å

PDB Description: Crystal structure of project TT0160 from Thermus thermophilus HB8
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2dvlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvlb2 a.29.3.0 (B:222-372) automated matches {Thermus thermophilus [TaxId: 300852]}
grglayalagldsgrvgvaaqavgiargafeiakayaeereqfgkklkehqaiafkiadm
hvkiaaaralvleaarkkdrgerftleasaaklfasaaavevtreavqvlggygyhrdyr
veryyrdakvteiyegtseiqrlviarelyr

SCOPe Domain Coordinates for d2dvlb2:

Click to download the PDB-style file with coordinates for d2dvlb2.
(The format of our PDB-style files is described here.)

Timeline for d2dvlb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dvlb1