| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
| Protein automated matches [226935] (30 species) not a true protein |
| Species Thermus thermophilus [TaxId:300852] [267776] (1 PDB entry) |
| Domain d2dvla2: 2dvl A:222-372 [264262] Other proteins in same PDB: d2dvla1, d2dvlb1 automated match to d4l1fa2 complexed with fad |
PDB Entry: 2dvl (more details), 2.5 Å
SCOPe Domain Sequences for d2dvla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dvla2 a.29.3.0 (A:222-372) automated matches {Thermus thermophilus [TaxId: 300852]}
grglayalagldsgrvgvaaqavgiargafeiakayaeereqfgkklkehqaiafkiadm
hvkiaaaralvleaarkkdrgerftleasaaklfasaaavevtreavqvlggygyhrdyr
veryyrdakvteiyegtseiqrlviarelyr
Timeline for d2dvla2: