SCOPe 2.08: Domain d2dvla1: 2dvl A:3-221

Lineage for d2dvla1 (2dvl A:3-221)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (29 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [267775] (1 PDB entry)

8. Domain d2dvla1: 2dvl A:3-221 [264261]
   Other proteins in same PDB: d2dvla2, d2dvlb2
   automated match to d4l1fa1
   complexed with fad

Details for d2dvla1

PDB Entry: 2dvl, 2.5 Å

PDB Description: Crystal structure of project TT0160 from Thermus thermophilus HB8

PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2dvla1:

Sequence; same for both SEQRES and ATOM records:

>d2dvla1 e.6.1.0 (A:3-221) automated matches {Thermus thermophilus [TaxId: 300852]}
ltqeqrlvldavrrvarevlyplapeydrkaeypwpqlkalaelgllgmttpeewggvgl
dsvtwalaleelaaadpsvavivsvtsglpqymllrfgseaqkrrylvplargewigafc
ltepqagsdakslraearrvkggfvlngvkswitsaghahlyvvmartekgisaflvekg
tpglsfgrpeekmglhaahtaevrleevfvpeenllgee

Timeline for d2dvla1:

• d2dvla1 first appeared in SCOPe 2.05
  
• d2dvla1 appears in SCOPe 2.07