Lineage for d2dl5a_ (2dl5 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1783907Species Human (Homo sapiens) [TaxId:9606] [187598] (88 PDB entries)
  8. 1784020Domain d2dl5a_: 2dl5 A: [264256]
    automated match to d1wxba_

Details for d2dl5a_

PDB Entry: 2dl5 (more details)

PDB Description: solution structure of the first sh3 domain of human kiaa0769 protein
PDB Compounds: (A:) KIAA0769 protein

SCOPe Domain Sequences for d2dl5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dl5a_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgtlrnypltckvvysykasqpdeltieehevleviedgdmedwvkarnkvgqvg
yvpekylqfptssgpssg

SCOPe Domain Coordinates for d2dl5a_:

Click to download the PDB-style file with coordinates for d2dl5a_.
(The format of our PDB-style files is described here.)

Timeline for d2dl5a_: