Lineage for d2dkua_ (2dku A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766523Domain d2dkua_: 2dku A: [264255]
    automated match to d2edfa_

Details for d2dkua_

PDB Entry: 2dku (more details)

PDB Description: Solution structure of the third Ig-like domain of human KIAA1556 protein
PDB Compounds: (A:) KIAA1556 protein

SCOPe Domain Sequences for d2dkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dkua_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgancfteeltnlqveekgtavftcktehpaatvtwrkgllelrasgkhqpsqeg
ltlrltisalekadsdtytcdigqaqsraqllvqgrrsgpssg

SCOPe Domain Coordinates for d2dkua_:

Click to download the PDB-style file with coordinates for d2dkua_.
(The format of our PDB-style files is described here.)

Timeline for d2dkua_: