| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (11 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [226227] (6 PDB entries) |
| Domain d2dgoa1: 2dgo A:70-171 [264253] Other proteins in same PDB: d2dgoa2, d2dgoa3 automated match to d2dgua_ |
PDB Entry: 2dgo (more details)
SCOPe Domain Sequences for d2dgoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dgoa1 d.58.7.0 (A:70-171) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qkkdtsnhfhvfvgdlspeittedikaafapfgrisdarvvkdmatgkskgygfvsffnk
wdaenaiqqmggqwlggrqirtnwatrkppapkstyesntkq
Timeline for d2dgoa1: