Lineage for d2dgoa1 (2dgo A:70-171)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2519561Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2519562Protein automated matches [190896] (11 species)
    not a true protein
  7. 2519751Species Mouse (Mus musculus) [TaxId:10090] [226227] (6 PDB entries)
  8. 2519756Domain d2dgoa1: 2dgo A:70-171 [264253]
    Other proteins in same PDB: d2dgoa2, d2dgoa3
    automated match to d2dgua_

Details for d2dgoa1

PDB Entry: 2dgo (more details)

PDB Description: Solution structure of the RNA binding domain in cytotoxic granule-associated RNA binding protein 1
PDB Compounds: (A:) Cytotoxic granule-associated RNA binding protein 1

SCOPe Domain Sequences for d2dgoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dgoa1 d.58.7.0 (A:70-171) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qkkdtsnhfhvfvgdlspeittedikaafapfgrisdarvvkdmatgkskgygfvsffnk
wdaenaiqqmggqwlggrqirtnwatrkppapkstyesntkq

SCOPe Domain Coordinates for d2dgoa1:

Click to download the PDB-style file with coordinates for d2dgoa1.
(The format of our PDB-style files is described here.)

Timeline for d2dgoa1: