Lineage for d2debb1 (2deb B:441-657)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851362Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 1851363Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) (S)
  5. 1851531Family c.43.1.0: automated matches [191456] (1 protein)
    not a true family
  6. 1851532Protein automated matches [190703] (6 species)
    not a true protein
  7. 1851580Species Norway rat (Rattus norvegicus) [TaxId:10116] [267774] (8 PDB entries)
  8. 1851582Domain d2debb1: 2deb B:441-657 [264252]
    automated match to d1nm8a2
    complexed with bog, coa, plm

Details for d2debb1

PDB Entry: 2deb (more details), 1.6 Å

PDB Description: crystal structure of rat carnitine palmitoyltransferase 2 in space group c2221
PDB Compounds: (B:) Carnitine O-palmitoyltransferase II, mitochondrial

SCOPe Domain Sequences for d2debb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2debb1 c.43.1.0 (B:441-657) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrte
tirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalr
ylatarglnlpelyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddw
igcnvssysgrnareflhcvqkcledifdalegkaik

SCOPe Domain Coordinates for d2debb1:

Click to download the PDB-style file with coordinates for d2debb1.
(The format of our PDB-style files is described here.)

Timeline for d2debb1: