SCOPe 2.08: Domain d2dcra1: 2dcr A:8-108

Lineage for d2dcra1 (2dcr A:8-108)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)

8. Domain d2dcra1: 2dcr A:8-108 [264250]
   Other proteins in same PDB: d2dcra2, d2dcra3
   automated match to d2dlya_

Details for d2dcra1

PDB Entry: 2dcr

PDB Description: fully automated solution structure determination of the fes sh2 domain

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Fes/Fps

SCOPe Domain Sequences for d2dcra1:

Sequence; same for both SEQRES and ATOM records:

>d2dcra1 d.93.1.0 (A:8-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqkplheqlwyhgaipraevaellvhsgdflvresqgkqeyvlsvlwdglprhfiiqsl
dnlyrlegegfpsipllidhllstqqpltkksgvvlhravp

Timeline for d2dcra1:

• d2dcra1 first appeared in SCOPe 2.05, called d2dcra_
  
• d2dcra1 appears in SCOPe 2.07