Lineage for d2dcra1 (2dcr A:8-108)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530930Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2530931Protein automated matches [190561] (4 species)
    not a true protein
  7. 2530932Species Human (Homo sapiens) [TaxId:9606] [187549] (76 PDB entries)
  8. 2531019Domain d2dcra1: 2dcr A:8-108 [264250]
    Other proteins in same PDB: d2dcra2, d2dcra3
    automated match to d2dlya_

Details for d2dcra1

PDB Entry: 2dcr (more details)

PDB Description: Fully automated solution structure determination of the Fes SH2 domain
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Fes/Fps

SCOPe Domain Sequences for d2dcra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dcra1 d.93.1.0 (A:8-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqkplheqlwyhgaipraevaellvhsgdflvresqgkqeyvlsvlwdglprhfiiqsl
dnlyrlegegfpsipllidhllstqqpltkksgvvlhravp

SCOPe Domain Coordinates for d2dcra1:

Click to download the PDB-style file with coordinates for d2dcra1.
(The format of our PDB-style files is described here.)

Timeline for d2dcra1: