| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries) |
| Domain d2daoa1: 2dao A:8-112 [264249] Other proteins in same PDB: d2daoa2, d2daoa3 automated match to d2lf7a_ |
PDB Entry: 2dao (more details)
SCOPe Domain Sequences for d2daoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2daoa1 a.4.5.0 (A:8-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
crllwdyvyqllsdsryenfirwedkeskifrivdpnglarlwgnhknrtnmtyekmsra
lrhyyklniirkepgqrllfrfmktpdeimsgrtdrlehlesqel
Timeline for d2daoa1: