Lineage for d2d7la1 (2d7l A:8-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2698036Family a.21.1.0: automated matches [191668] (1 protein)
    not a true family
  6. 2698037Protein automated matches [191268] (4 species)
    not a true protein
  7. 2698040Species Human (Homo sapiens) [TaxId:9606] [189843] (8 PDB entries)
  8. 2698047Domain d2d7la1: 2d7l A:8-75 [264247]
    Other proteins in same PDB: d2d7la2, d2d7la3
    automated match to d2yula_

Details for d2d7la1

PDB Entry: 2d7l (more details)

PDB Description: solution structure of the hmg box domain from human wd repeat and hmg- box dna binding protein 1
PDB Compounds: (A:) WD repeat and HMG-box DNA binding protein 1

SCOPe Domain Sequences for d2d7la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7la1 a.21.1.0 (A:8-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpktgfqmwleenrsnilsdnpdfsdeadiikegmirfrvlsteerkvwankakgetase
gteakkrk

SCOPe Domain Coordinates for d2d7la1:

Click to download the PDB-style file with coordinates for d2d7la1.
(The format of our PDB-style files is described here.)

Timeline for d2d7la1: