SCOPe 2.07: Domain d2d7la1: 2d7l A:8-75

Lineage for d2d7la1 (2d7l A:8-75)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.0: automated matches [191668] (1 protein)
   not a true family

6. Protein automated matches [191268] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189843] (6 PDB entries)

8. Domain d2d7la1: 2d7l A:8-75 [264247]
   Other proteins in same PDB: d2d7la2, d2d7la3
   automated match to d2yula_

Details for d2d7la1

PDB Entry: 2d7l

PDB Description: Solution structure of the HMG box domain from human WD repeat and HMG-box DNA binding protein 1

PDB Compounds: (A:) WD repeat and HMG-box DNA binding protein 1

SCOPe Domain Sequences for d2d7la1:

Sequence; same for both SEQRES and ATOM records:

>d2d7la1 a.21.1.0 (A:8-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpktgfqmwleenrsnilsdnpdfsdeadiikegmirfrvlsteerkvwankakgetase
gteakkrk

Timeline for d2d7la1:

• d2d7la1 first appeared in SCOPe 2.05, called d2d7la_
  
• d2d7la1 appears in SCOPe 2.06