Lineage for d2cyaa_ (2cya A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106028Species Aeropyrum pernix [TaxId:56636] [189259] (3 PDB entries)
  8. 2106030Domain d2cyaa_: 2cya A: [264246]
    automated match to d2dlcx_
    complexed with so4

Details for d2cyaa_

PDB Entry: 2cya (more details), 2.2 Å

PDB Description: Crystal structure of tyrosyl-tRNA synthetase from Aeropyrum pernix
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d2cyaa_:

Sequence, based on SEQRES records: (download)

>d2cyaa_ c.26.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 56636]}
vdveerfnriarntveivteeelkgllasgarikgyigyepsgvahigwlvwmykvkdlv
eagvdfsvleatwhayindklggdmdliraaarivrrvmeaagvpvervrfvdaeelasd
kdywglvirvakraslarvrraltimgrraeeaevdaskliyplmqvsdifymdldialg
gmdqrkahmlardvaeklgrkkpvaihtpiisslqgpgrmeasqgeiddvlaevkmsksk
petavfvvdsdddirrkirkaycpakqvqgnpvleiaryilfardgftlrvdrpakyggp
veytsyeelerdytdgrlhpldlknavaeslievvrpirgavlgdpamkraleaiegk

Sequence, based on observed residues (ATOM records): (download)

>d2cyaa_ c.26.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 56636]}
vdveerfnriarntveivteeelkgllasgarikgyigyepsgvahigwlvwmykvkdlv
eagvdfsvleatwhayindklggdmdliraaarivrrvmeaagvpvervrfvdaeelasd
kdywglvirvakraslarvrralaeeaevdaskliyplmqvsdifymdldialggmdqrk
ahmlardvaeklgrkkpvaihtpiisslqgpvkmskskpetavfvvdsdddirrkirkay
cpakqvqgnpvleiaryilfardgftlrvdveytsyeelerdytdgrlhpldlknavaes
lievvrpirgavlgdpamkraleaiegk

SCOPe Domain Coordinates for d2cyaa_:

Click to download the PDB-style file with coordinates for d2cyaa_.
(The format of our PDB-style files is described here.)

Timeline for d2cyaa_: