Lineage for d2cy8a_ (2cy8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132836Species Pseudomonas stutzeri [TaxId:316] [267772] (1 PDB entry)
  8. 2132837Domain d2cy8a_: 2cy8 A: [264245]
    automated match to d3bs8a_

Details for d2cy8a_

PDB Entry: 2cy8 (more details), 2.3 Å

PDB Description: Crystal structure of D-phenylglycine aminotransferase (D-PhgAT) from Pseudomonas strutzeri ST-201
PDB Compounds: (A:) D-phenylglycine aminotransferase

SCOPe Domain Sequences for d2cy8a_:

Sequence, based on SEQRES records: (download)

>d2cy8a_ c.67.1.0 (A:) automated matches {Pseudomonas stutzeri [TaxId: 316]}
silndykrktegsvfwaqrarsvmpdgvtadtrafdphglfisdaqgvhktdvdgnvyld
ffgghgalvlghghprvnaaiaealshgvqyaashplevrwaerivaafpsirklrftgs
gtettllalrvaraftgrrmilrfeghyhgwhdfsasgynshfdgqpapgvlpettantl
lirpddiegmrevfanhgsdiaafiaepvgshfgvtpvsdsflregaelarqygalfild
evisgfrvgnhgmqalldvqpdltclakasagglpggilggredvmgvlsrgsdrkvlhq
gtftgnpitaaaaiaaidtileddvcakindlgqfareamnhlfarkglnwlaygrfsgf
hlmpglppnttdtgsitraevarpdvkmiaamrmalilegvdiggrgsvflsaqherehv
ehlvttfdrvldrladenllswqgt

Sequence, based on observed residues (ATOM records): (download)

>d2cy8a_ c.67.1.0 (A:) automated matches {Pseudomonas stutzeri [TaxId: 316]}
silndykrktegsvfwaqrarsvmpdgafdphglfisdaqgvhktdvdgnvyldffgghg
alvlghghprvnaaiaealshgvqyaashplevrwaerivaafpsirklrftgsgtettl
lalrvaraftgrrmilrfegttantllirpddiegmrevfanhgsdiaafiaepvgshfg
vtpvsdsflregaelarqygalfildevisgfrvgnhgmqalldvqpdltclakasaggl
pggilggredvmgvlsrgsftgnpitaaaaiaaidtileddvcakindlgqfareamnhl
farkglnwlaygrfsgfhlmpglppnttdtgsitraevarpdvkmiaamrmalilegvdi
ggrgsvflsaqherehvehlvttfdrvldrladenllswqgt

SCOPe Domain Coordinates for d2cy8a_:

Click to download the PDB-style file with coordinates for d2cy8a_.
(The format of our PDB-style files is described here.)

Timeline for d2cy8a_: