Lineage for d2cr6a1 (2cr6 A:8-109)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2357684Domain d2cr6a1: 2cr6 A:8-109 [264242]
    Other proteins in same PDB: d2cr6a2, d2cr6a3
    automated match to d2edfa_

Details for d2cr6a1

PDB Entry: 2cr6 (more details)

PDB Description: Solution structure of the Ig domain (2998-3100) of human obscurin
PDB Compounds: (A:) KIAA1556 protein

SCOPe Domain Sequences for d2cr6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cr6a1 b.1.1.0 (A:8-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvqgrrvhiiedledvdvqegssatfrcrispanyepvhwfldktplhanelneidaqpg
gyhvltlrqlalkdsgtiyfeagdqrasaalrvtekpsvfsr

SCOPe Domain Coordinates for d2cr6a1:

Click to download the PDB-style file with coordinates for d2cr6a1.
(The format of our PDB-style files is described here.)

Timeline for d2cr6a1: