Lineage for d2c1fa_ (2c1f A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1782102Species Neocallimastix patriciarum [TaxId:4758] [237916] (5 PDB entries)
  8. 1782106Domain d2c1fa_: 2c1f A: [264241]
    automated match to d2vg9a_
    complexed with cd

Details for d2c1fa_

PDB Entry: 2c1f (more details), 2.1 Å

PDB Description: the structure of the family 11 xylanase from neocallimastix patriciarum
PDB Compounds: (A:) bifunctional endo-1,4-beta-xylanase a

SCOPe Domain Sequences for d2c1fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1fa_ b.29.1.0 (A:) automated matches {Neocallimastix patriciarum [TaxId: 4758]}
mkftvgngqnqhkgvndgfsyeiwldntggngsmtlgsgatfkaewnaavnrgnflarrg
ldfgsqkkatdydyigldyaatykqtasasgnsrlcvygwfqnrglngvplveyyiiedw
vdwvpdaqgkmvtidgaqykifqmdhtgptinggsetfkqyfsvrqqkrtsghitvsdhf
kewakqgwgignlyevalnaegwqssgvadvtlldvytt

SCOPe Domain Coordinates for d2c1fa_:

Click to download the PDB-style file with coordinates for d2c1fa_.
(The format of our PDB-style files is described here.)

Timeline for d2c1fa_: