Lineage for d1havb_ (1hav B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 112433Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (2 proteins)
  6. 112438Protein 3C cysteine protease (picornain 3C) [50604] (2 species)
  7. 112439Species Human hepatitis A virus [TaxId:208726] [50606] (2 PDB entries)
  8. 112441Domain d1havb_: 1hav B: [26424]

Details for d1havb_

PDB Entry: 1hav (more details), 2 Å

PDB Description: hepatitis a virus 3c proteinase

SCOP Domain Sequences for d1havb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1havb_ b.47.1.4 (B:) 3C cysteine protease (picornain 3C) {Human hepatitis A virus}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqnidk

SCOP Domain Coordinates for d1havb_:

Click to download the PDB-style file with coordinates for d1havb_.
(The format of our PDB-style files is described here.)

Timeline for d1havb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hava_