Lineage for d1havb_ (1hav B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2057861Protein 3C cysteine protease (picornain 3C) [50604] (9 species)
  7. 2057894Species Human hepatitis A virus [TaxId:208726] [50606] (5 PDB entries)
  8. 2057903Domain d1havb_: 1hav B: [26424]
    complexed with cl

Details for d1havb_

PDB Entry: 1hav (more details), 2 Å

PDB Description: hepatitis a virus 3c proteinase
PDB Compounds: (B:) hepatitis a virus 3c proteinase

SCOPe Domain Sequences for d1havb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1havb_ b.47.1.4 (B:) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqnidk

SCOPe Domain Coordinates for d1havb_:

Click to download the PDB-style file with coordinates for d1havb_.
(The format of our PDB-style files is described here.)

Timeline for d1havb_: