Class b: All beta proteins [48724] (180 folds) |
Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily) complex fold made of five beta-hairpin units and a b-ribbon arc |
Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) duplication: contains two intertwined structural repeats |
Family b.86.1.0: automated matches [254252] (1 protein) not a true family |
Protein automated matches [254576] (4 species) not a true protein |
Species Synechocystis sp. [TaxId:1148] [267771] (3 PDB entries) |
Domain d1zd7a_: 1zd7 A: [264232] automated match to d4kl6b_ complexed with so4 |
PDB Entry: 1zd7 (more details), 1.7 Å
SCOPe Domain Sequences for d1zd7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zd7a_ b.86.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]} clsfgteiltveygplpigkivseeincsvysvdpegrvytqaiaqwhdrgeqevleyel edgsviratsdhrflttdyqllaieeifarqldlltlenikqteealdnhrlpfplldag tikmvkvigrrslgvqrifdiglpqdhnfllangaiaan
Timeline for d1zd7a_: