Lineage for d1zd7a_ (1zd7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2818758Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 2818759Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) (S)
    duplication: contains two intertwined structural repeats
  5. 2818801Family b.86.1.0: automated matches [254252] (1 protein)
    not a true family
  6. 2818802Protein automated matches [254576] (4 species)
    not a true protein
  7. 2818815Species Synechocystis sp. [TaxId:1148] [267771] (3 PDB entries)
  8. 2818817Domain d1zd7a_: 1zd7 A: [264232]
    automated match to d4kl6b_
    complexed with so4

Details for d1zd7a_

PDB Entry: 1zd7 (more details), 1.7 Å

PDB Description: 1.7 Angstrom Crystal Structure Of Post-Splicing Form of a dnaE Intein from Synechocystis Sp. Pcc 6803
PDB Compounds: (A:) DNA polymerase III alpha subunit

SCOPe Domain Sequences for d1zd7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zd7a_ b.86.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
clsfgteiltveygplpigkivseeincsvysvdpegrvytqaiaqwhdrgeqevleyel
edgsviratsdhrflttdyqllaieeifarqldlltlenikqteealdnhrlpfplldag
tikmvkvigrrslgvqrifdiglpqdhnfllangaiaan

SCOPe Domain Coordinates for d1zd7a_:

Click to download the PDB-style file with coordinates for d1zd7a_.
(The format of our PDB-style files is described here.)

Timeline for d1zd7a_: