Lineage for d1z2qa1 (1z2q A:7-84)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. Protein automated matches [190772] (6 species)
    not a true protein
  7. Species Leishmania major [TaxId:5664] [267770] (1 PDB entry)
  8. Domain d1z2qa1: 1z2q A:7-84 [264229]
    Other proteins in same PDB: d1z2qa2
    automated match to d3t7la_

Details for d1z2qa1

PDB Entry: 1z2q (more details)

PDB Description: high-resolution solution structure of the lm5-1 fyve domain from leishmania major
PDB Compounds: (A:) lm5-1

SCOPe Domain Sequences for d1z2qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z2qa1 g.50.1.0 (A:7-84) automated matches {Leishmania major [TaxId: 5664]}
gekqskgywqededapacngcgcvftttvrrhhcrncgyvlcgdcsrhraaipmrgitep
ervcdacylalrssnmag

SCOPe Domain Coordinates for d1z2qa1 are not available.

Timeline for d1z2qa1:

Domains from same chain:
(mouse over for more information)
d1z2qa2