Lineage for d1z1la1 (1z1l A:578-915)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. Protein automated matches [190983] (12 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)
  8. Domain d1z1la1: 1z1l A:578-915 [264224]
    Other proteins in same PDB: d1z1la2
    automated match to d4d09c_
    complexed with mg, po4, zn

Details for d1z1la1

PDB Entry: 1z1l (more details), 1.7 Å

PDB Description: The Crystal Structure of the Phosphodiesterase 2A Catalytic Domain
PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d1z1la1:

Sequence, based on SEQRES records: (download)

>d1z1la1 a.211.1.0 (A:578-915) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcp
tlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchd
ldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrm
ldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwk
ttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdl
fpkaaelyervasnrehwtkvshkftirglpsnnsldf

Sequence, based on observed residues (ATOM records): (download)

>d1z1la1 a.211.1.0 (A:578-915) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcp
tlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchd
ldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrm
ldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwk
ttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdl
fpkaaelyervasnrehwtkvsftirglpsnnsldf

SCOPe Domain Coordinates for d1z1la1 are not available.

Timeline for d1z1la1:

Domains from same chain:
(mouse over for more information)
d1z1la2