Lineage for d1yisa_ (1yis A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010494Species Nematode (Caenorhabditis elegans) [TaxId:6239] [267768] (1 PDB entry)
  8. 2010495Domain d1yisa_: 1yis A: [264223]
    automated match to d4ffxc_
    complexed with so4

Details for d1yisa_

PDB Entry: 1yis (more details), 2.4 Å

PDB Description: Structural genomics of Caenorhabditis elegans: adenylosuccinate lyase
PDB Compounds: (A:) adenylosuccinate lyase

SCOPe Domain Sequences for d1yisa_:

Sequence, based on SEQRES records: (download)

>d1yisa_ a.127.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
asedkfesvlstrycknsplvsilsetnkatlwrqlwiwlaeaekelglkqvtqdaidem
ksnrdvfdwpfirseerklkhdvmahnhafgklcptaagiihlgatscfvqdnadliayr
dsidhilkrfatvidrlaafslknkevvtvgrthyqtaslvtvgkrgvlwaqellmafqs
lsefrdkmrfrgikgatgtqdsfltlfagdeskvealdelvtkkanfsnrflitgqtysr
qqdsqlvfslsllgaaakkvctdirvlqafgellepfekdqigssampykknpmksercc
alsrklinapqealtiladqglertlddsagrrmlipdvlltaeallttlqnifeglsvq
tdnvkkivedeiaflglekammmlteegvdrqqahavirktaleakqlqatqkvdirqtm
adpffdsvrdrvvglvnnpinftgrcvsqtesfiakelkptidkyld

Sequence, based on observed residues (ATOM records): (download)

>d1yisa_ a.127.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
asedkfesvlstrycknsplvsilsetnkatlwrqlwiwlaeaekelglkqvtqdaidem
ksnrdvfdwpfirseerklkhdvmahnhafgklcptaagiihlgatscfvqdnadliayr
dsidhilkrfatvidrlaafslknkevvtvgrthyqtaslvtvgkrgvlwaqellmafqs
lsefrdkmrfrgikgatgtqdsfltlfagdeskvealdelvtkkanfsnrflitgqtysr
qqdsqlvfslsllgaaakkvctdirvlqafgellepkknpmkserccalsrklinapqea
ltiladqglertlddsagrrmlipdvlltaeallttlqnifeglsvqtdnvkkivedeia
flglekammmlqtmadpffdsvrdrvvglvnnpinftgrcvsqtesfiakelkptidkyl
d

SCOPe Domain Coordinates for d1yisa_:

Click to download the PDB-style file with coordinates for d1yisa_.
(The format of our PDB-style files is described here.)

Timeline for d1yisa_: