Lineage for d1ybwa_ (1ybw A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056486Protein Hepatocyte growth factor activator, HGFA [267665] (1 species)
  7. 2056487Species Human (Homo sapiens) [TaxId:9606] [267750] (2 PDB entries)
  8. 2056489Domain d1ybwa_: 1ybw A: [264221]
    complexed with nag

Details for d1ybwa_

PDB Entry: 1ybw (more details), 2.7 Å

PDB Description: Protease domain of HGFA with no inhibitor
PDB Compounds: (A:) Hepatocyte growth factor activator precursor

SCOPe Domain Sequences for d1ybwa_:

Sequence, based on SEQRES records: (download)

>d1ybwa_ b.47.1.2 (A:) Hepatocyte growth factor activator, HGFA {Human (Homo sapiens) [TaxId: 9606]}
acgrrhkkrtflrpriiggssslpgshpwlaaiyigdsfcagslvhtcwvvsaahcfshs
pprdsvsvvlgqhffnrttdvtqtfgiekyipytlysvfnpsdhdlvlirlkkkgdrcat
rsqfvqpiclpepgstfpaghkcqiagwghldenvsgyssslrealvplvadhkcsspev
ygadispnmlcagyfdcksdacqgdsggplacekngvaylygiiswgdgcgrlhkpgvyt
rvanyvdwindri

Sequence, based on observed residues (ATOM records): (download)

>d1ybwa_ b.47.1.2 (A:) Hepatocyte growth factor activator, HGFA {Human (Homo sapiens) [TaxId: 9606]}
acgrrhkkiiggssslpgshpwlaaiyigdsfcagslvhtcwvvsaahcfshspprdsvs
vvlgqhffnrttdvtqtfgiekyipytlysvfnpsdhdlvlirlkkkgdrcatrsqfvqp
iclpepgstfpaghkcqiagwghldenvsgyssslrealvplvadhkcsspevygadisp
nmlcagyfdcksdacqgdsggplacekngvaylygiiswgdgcgrlhkpgvytrvanyvd
windri

SCOPe Domain Coordinates for d1ybwa_:

Click to download the PDB-style file with coordinates for d1ybwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ybwa_: