Lineage for d1y8ga_ (1y8g A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2591262Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2591263Protein automated matches [190417] (35 species)
    not a true protein
  7. 2593573Species Norway rat (Rattus norvegicus) [TaxId:10116] [267767] (8 PDB entries)
  8. 2593574Domain d1y8ga_: 1y8g A: [264219]
    automated match to d4ic8a_
    mutant

Details for d1y8ga_

PDB Entry: 1y8g (more details), 2.5 Å

PDB Description: Catalytic and ubiqutin-associated domains of MARK2/PAR-1: Inactive double mutant with selenomethionine
PDB Compounds: (A:) MAP/Microtubule affinity-regulating kinase 2

SCOPe Domain Sequences for d1y8ga_:

Sequence, based on SEQRES records: (download)

>d1y8ga_ d.144.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hignyrllktigkgnfakvklarhiltgkevavkiidktqlnssslqklfrevrimkvln
hpnivklfevietektlylvmeyasggevfdylvahgrmkekearakfrqivsavqychq
kfivhrdlkaenllldadmnikiadfgfsneftfgnkldafcgappyaapelfqgkkydg
pevdvwslgvilytlvsgslpfdgqnlkelrervlrgkyripfymstdcenllkkfliln
pskrgtleqimkdrwmnvgheddelkpyveplpdykdprrtelmvsmgytreeiqdslvg
qrynevmatylllgy

Sequence, based on observed residues (ATOM records): (download)

>d1y8ga_ d.144.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hignyrllktigkgnfakvklarhiltgkevavkiidktqlnssslqklfrevrimkvln
hpnivklfevietektlylvmeyasggevfdylvahgrmkekearakfrqivsavqychq
kfivhrdlkaenllldadmnikialdafcgappyaapelfqgkkydgpevdvwslgvily
tlvsgslpfdgqnlkelrervlrgkyripfymstdcenllkkflilnpskrgtleqimkd
rwmnvgheddelkpyveplpdykdprrtelmvsmgytreeiqdslvgqrynevmatylll
gy

SCOPe Domain Coordinates for d1y8ga_:

Click to download the PDB-style file with coordinates for d1y8ga_.
(The format of our PDB-style files is described here.)

Timeline for d1y8ga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y8gb_