Lineage for d1y37b_ (1y37 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152824Species Burkholderia sp. [TaxId:384033] [267766] (1 PDB entry)
  8. 2152826Domain d1y37b_: 1y37 B: [264217]
    automated match to d3qyjb_
    complexed with mg

Details for d1y37b_

PDB Entry: 1y37 (more details), 1.5 Å

PDB Description: Structure of Fluoroacetate Dehalogenase from Burkholderia sp. FA1
PDB Compounds: (B:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d1y37b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y37b_ c.69.1.0 (B:) automated matches {Burkholderia sp. [TaxId: 384033]}
mfegferrlvdvgdvtincvvggsgpallllhgfpqnlhmwarvapllaneytvvcadlr
gyggsskpvgapdhanysframasdqrelmrtlgferfhlvghdrggrtghrmaldhpds
vlslavldiiptyvmfeevdrfvaraywhwyflqqpapypekvigadpdtfyegclfgwg
atgadgfdpeqleeyrkqwrdpaaihgsccdyraggtidfeldhgdlgrqvqcpalvfsg
saglmhslfemqvvwaprlanmrfaslpgghffvdrfpddtarilreflsdars

SCOPe Domain Coordinates for d1y37b_:

Click to download the PDB-style file with coordinates for d1y37b_.
(The format of our PDB-style files is described here.)

Timeline for d1y37b_: