![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.218: YgfY-like [109909] (1 superfamily) 5 helices; array; forms a tight dimer in crystals |
![]() | Superfamily a.218.1: YgfY-like [109910] (2 families) ![]() |
![]() | Family a.218.1.0: automated matches [254244] (1 protein) not a true family |
![]() | Protein automated matches [254560] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [267765] (2 PDB entries) |
![]() | Domain d1x6ja_: 1x6j A: [264215] automated match to d2jr5a_ |
PDB Entry: 1x6j (more details), 2 Å
SCOPe Domain Sequences for d1x6ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6ja_ a.218.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} mdinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlmn hgkpadaelemmvrliqtrnrergpvai
Timeline for d1x6ja_: