SCOPe 2.05: Domain d1x6ib_: 1x6i B:

Lineage for d1x6ib_ (1x6i B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.218: YgfY-like [109909] (1 superfamily)
   5 helices; array; forms a tight dimer in crystals

4. Superfamily a.218.1: YgfY-like [109910] (2 families)

5. Family a.218.1.0: automated matches [254244] (1 protein)
   not a true family

6. Protein automated matches [254560] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [267765] (2 PDB entries)

8. Domain d1x6ib_: 1x6i B: [264214]
   automated match to d2jr5a_

Details for d1x6ib_

PDB Entry: 1x6i, 1.2 Å

PDB Description: crystal structure of ygfy from escherichia coli

PDB Compounds: (B:) Hypothetical protein ygfY

SCOPe Domain Sequences for d1x6ib_:

Sequence; same for both SEQRES and ATOM records:

>d1x6ib_ a.218.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
mdinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlmn
hgkpadaelemmvrliqtrnrergpva

Timeline for d1x6ib_:

• d1x6ib_ is new in SCOPe 2.05-stable
  
• d1x6ib_ appears in SCOPe 2.06
  
• d1x6ib_ appears in the current release, SCOPe 2.08