Lineage for d1x6ib_ (1x6i B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737726Fold a.218: YgfY-like [109909] (1 superfamily)
    5 helices; array; forms a tight dimer in crystals
  4. 2737727Superfamily a.218.1: YgfY-like [109910] (2 families) (S)
  5. 2737732Family a.218.1.0: automated matches [254244] (1 protein)
    not a true family
  6. 2737733Protein automated matches [254560] (3 species)
    not a true protein
  7. 2737734Species Escherichia coli [TaxId:562] [267765] (3 PDB entries)
  8. 2737736Domain d1x6ib_: 1x6i B: [264214]
    Other proteins in same PDB: d1x6ia2
    automated match to d2jr5a_

Details for d1x6ib_

PDB Entry: 1x6i (more details), 1.2 Å

PDB Description: crystal structure of ygfy from escherichia coli
PDB Compounds: (B:) Hypothetical protein ygfY

SCOPe Domain Sequences for d1x6ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6ib_ a.218.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
mdinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlmn
hgkpadaelemmvrliqtrnrergpva

SCOPe Domain Coordinates for d1x6ib_:

Click to download the PDB-style file with coordinates for d1x6ib_.
(The format of our PDB-style files is described here.)

Timeline for d1x6ib_: