Class a: All alpha proteins [46456] (286 folds) |
Fold a.218: YgfY-like [109909] (1 superfamily) 5 helices; array; forms a tight dimer in crystals |
Superfamily a.218.1: YgfY-like [109910] (2 families) |
Family a.218.1.0: automated matches [254244] (1 protein) not a true family |
Protein automated matches [254560] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [267765] (2 PDB entries) |
Domain d1x6ia_: 1x6i A: [264213] automated match to d2jr5a_ |
PDB Entry: 1x6i (more details), 1.2 Å
SCOPe Domain Sequences for d1x6ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6ia_ a.218.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} hmdinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlm nhgkpadaelemmvrliqtrnrergpvai
Timeline for d1x6ia_: