Lineage for d1x5ea1 (1x5e A:8-120)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. Protein automated matches [190056] (192 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. Domain d1x5ea1: 1x5e A:8-120 [264210]
    Other proteins in same PDB: d1x5ea2, d1x5ea3
    automated match to d1x5da_

Details for d1x5ea1

PDB Entry: 1x5e (more details)

PDB Description: The solution structure of the thioredoxin-like domain of human Thioredoxin-related transmembrane protein
PDB Compounds: (A:) Thioredoxin domain containing protein 1

SCOPe Domain Sequences for d1x5ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5ea1 c.47.1.0 (A:8-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvrvitdenwrellegdwmiefyapwcpacqnlqpewesfaewgedlevniakvdvteqp
glsgrfiinalptiyhckdgefrryqgprtkkdfinfisdkewksiepvsswf

SCOPe Domain Coordinates for d1x5ea1 are not available.

Timeline for d1x5ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x5ea2, d1x5ea3