Lineage for d1df9b_ (1df9 B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 15540Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 15541Protein NS3 protease [50600] (2 species)
  7. 15542Species Dengue virus serotype 2 [50602] (2 PDB entries)
  8. 15545Domain d1df9b_: 1df9 B: [26421]
    Other proteins in same PDB: d1df9c_

Details for d1df9b_

PDB Entry: 1df9 (more details), 2.1 Å

PDB Description: dengue virus ns3-protease complexed with mung-bean bowman-birk inhibitor

SCOP Domain Sequences for d1df9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1df9b_ b.47.1.3 (B:) NS3 protease {Dengue virus serotype 2}
wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd

SCOP Domain Coordinates for d1df9b_:

Click to download the PDB-style file with coordinates for d1df9b_.
(The format of our PDB-style files is described here.)

Timeline for d1df9b_: