SCOPe 2.06: Domain d1x0ca2: 1x0c A:185-564

Lineage for d1x0ca2 (1x0c A:185-564)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (12 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.0: automated matches [191490] (1 protein)
   not a true family

6. Protein automated matches [190791] (5 species)
   not a true protein

7. Species Aspergillus niger [TaxId:5061] [261058] (4 PDB entries)

8. Domain d1x0ca2: 1x0c A:185-564 [264207]
   Other proteins in same PDB: d1x0ca1, d1x0ca3, d1x0cb1, d1x0cb3
   automated match to d3wwgb2
   complexed with nag

Details for d1x0ca2

PDB Entry: 1x0c, 1.7 Å

PDB Description: improved crystal structure of isopullulanase from aspergillus niger atcc 9642

PDB Compounds: (A:) Isopullulanase

SCOPe Domain Sequences for d1x0ca2:

Sequence; same for both SEQRES and ATOM records:

>d1x0ca2 b.80.1.0 (A:185-564) automated matches {Aspergillus niger [TaxId: 5061]}
ensstkpqpgspnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfa
pgayvkgaveflstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlg
nssqtfvlngvtvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilq
dvfyhtdddglkmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayan
agnnpgifgavnnylyapdglssnhstgnsnmtvrnitwsnfraegsssalfrinpiqnl
dnisiknvsiesfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaa
svgridgvdpayagsvhyid

Timeline for d1x0ca2:

• d1x0ca2 first appeared in SCOPe 2.05
  
• d1x0ca2 appears in SCOPe 2.07
  
• d1x0ca2 appears in the current release, SCOPe 2.08