| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
| Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
| Protein automated matches [226856] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) |
| Domain d1wyna1: 1wyn A:8-140 [264205] Other proteins in same PDB: d1wyna2, d1wyna3 automated match to d1wypa_ |
PDB Entry: 1wyn (more details)
SCOPe Domain Sequences for d1wyna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wyna1 a.40.1.0 (A:8-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrllskydpqkeaelrtwiegltglsigpdfqkglkdgtilctlmnklqpgsvpkinrsm
qnwhqlenlsnfikamvsygmnpvdlfeandlfesgnmtqvqvsllalagkaktkglqsg
vdigvkysekqer
Timeline for d1wyna1: