Lineage for d1wyna1 (1wyn A:8-140)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321178Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2321179Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2321257Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2321258Protein automated matches [226856] (4 species)
    not a true protein
  7. 2321259Species Human (Homo sapiens) [TaxId:9606] [224978] (30 PDB entries)
  8. 2321330Domain d1wyna1: 1wyn A:8-140 [264205]
    Other proteins in same PDB: d1wyna2, d1wyna3
    automated match to d1wypa_

Details for d1wyna1

PDB Entry: 1wyn (more details)

PDB Description: Solution structure of the CH domain of human calponin-2
PDB Compounds: (A:) Calponin-2

SCOPe Domain Sequences for d1wyna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyna1 a.40.1.0 (A:8-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrllskydpqkeaelrtwiegltglsigpdfqkglkdgtilctlmnklqpgsvpkinrsm
qnwhqlenlsnfikamvsygmnpvdlfeandlfesgnmtqvqvsllalagkaktkglqsg
vdigvkysekqer

SCOPe Domain Coordinates for d1wyna1:

Click to download the PDB-style file with coordinates for d1wyna1.
(The format of our PDB-style files is described here.)

Timeline for d1wyna1: