| Class b: All beta proteins [48724] (165 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
| Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
| Protein NS3 protease [50600] (3 species) |
| Species Dengue virus type 2 [TaxId:11060] [50602] (3 PDB entries) |
| Domain d1df9a_: 1df9 A: [26420] Other proteins in same PDB: d1df9c_ |
PDB Entry: 1df9 (more details), 2.1 Å
SCOP Domain Sequences for d1df9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1df9a_ b.47.1.3 (A:) NS3 protease {Dengue virus type 2 [TaxId: 11060]}
wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd
Timeline for d1df9a_: