Lineage for d1wi7a1 (1wi7 A:8-62)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783623Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries)
  8. 2783656Domain d1wi7a1: 1wi7 A:8-62 [264198]
    Other proteins in same PDB: d1wi7a2, d1wi7a3
    automated match to d2da9a_

Details for d1wi7a1

PDB Entry: 1wi7 (more details)

PDB Description: solution structure of the sh3 domain of sh3-domain kinase binding protein 1
PDB Compounds: (A:) sh3-domain kinase binding protein 1

SCOPe Domain Sequences for d1wi7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wi7a1 b.34.2.0 (A:8-62) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rrcqvafsylpqnddelelkvgdiievvgeveegwwegvlngktgmfpsnfikel

SCOPe Domain Coordinates for d1wi7a1:

Click to download the PDB-style file with coordinates for d1wi7a1.
(The format of our PDB-style files is described here.)

Timeline for d1wi7a1: