Lineage for d1w99a2 (1w99 A:277-471)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079052Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2079059Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) (S)
  5. 2079060Family b.77.2.1: delta-Endotoxin (insectocide), middle domain [51097] (1 protein)
  6. 2079061Protein delta-Endotoxin (insectocide), middle domain [51098] (5 species)
  7. 2079068Species Bacillus thuringiensis, Cry4Ba [TaxId:1428] [267712] (1 PDB entry)
  8. 2079069Domain d1w99a2: 1w99 A:277-471 [264196]
    Other proteins in same PDB: d1w99a1, d1w99a3
    complexed with br, p6g

Details for d1w99a2

PDB Entry: 1w99 (more details), 1.75 Å

PDB Description: mosquito-larvicidal toxin cry4ba from bacillus thuringiensis ssp. israelensis
PDB Compounds: (A:) pesticidial crystal protein cry4ba

SCOPe Domain Sequences for d1w99a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w99a2 b.77.2.1 (A:277-471) delta-Endotoxin (insectocide), middle domain {Bacillus thuringiensis, Cry4Ba [TaxId: 1428]}
idntklskteftreiytalvespssksiaaleaaltrdvhlftwlkrvdfwtntiyqdlr
flsankigfsytnssamqesgiygssgfgsnlthqiqlnsnvyktsitdtsspsnrvtkm
dfykidgtlasynsnitptpeglrttffgfstnentpnqptvndythilsyiktdvidyn
snrvsfawthkivdp

SCOPe Domain Coordinates for d1w99a2:

Click to download the PDB-style file with coordinates for d1w99a2.
(The format of our PDB-style files is described here.)

Timeline for d1w99a2: