| Class b: All beta proteins [48724] (177 folds) |
| Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) ![]() |
| Family b.77.2.1: delta-Endotoxin (insectocide), middle domain [51097] (1 protein) |
| Protein delta-Endotoxin (insectocide), middle domain [51098] (5 species) |
| Species Bacillus thuringiensis, Cry4Ba [TaxId:1428] [267712] (1 PDB entry) |
| Domain d1w99a2: 1w99 A:277-471 [264196] Other proteins in same PDB: d1w99a1, d1w99a3 complexed with br, p6g |
PDB Entry: 1w99 (more details), 1.75 Å
SCOPe Domain Sequences for d1w99a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w99a2 b.77.2.1 (A:277-471) delta-Endotoxin (insectocide), middle domain {Bacillus thuringiensis, Cry4Ba [TaxId: 1428]}
idntklskteftreiytalvespssksiaaleaaltrdvhlftwlkrvdfwtntiyqdlr
flsankigfsytnssamqesgiygssgfgsnlthqiqlnsnvyktsitdtsspsnrvtkm
dfykidgtlasynsnitptpeglrttffgfstnentpnqptvndythilsyiktdvidyn
snrvsfawthkivdp
Timeline for d1w99a2: