Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (18 species) not a true protein |
Species Trypanosoma cruzi [TaxId:5693] [267764] (5 PDB entries) |
Domain d1w61a_: 1w61 A: [264191] Other proteins in same PDB: d1w61b2 automated match to d4q2ha_ complexed with pyc |
PDB Entry: 1w61 (more details), 2.1 Å
SCOPe Domain Sequences for d1w61a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w61a_ d.21.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]} fkksftcidmhtegeaarivtsglphipgsnmaekkaylqenmdylrrgimleprghddm fgaflfdpieegadlgivfmdtggylnmcghnsiaavtaavetgivsvpakatnvpvvld tpaglvrgtahlqsgtesevsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffa ivpaeqlgidisvqnlsrlqeagellrteinrsvkvqhpqlphintvdcveiygpptnpe anyknvvifgnrqadrspcgtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgee ripgvkvpvtkdaeegmlvvtaeitgkafimgfntmlfdptdpfkngftlkqy
Timeline for d1w61a_: