Lineage for d1w4ka_ (1w4k A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697346Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2697347Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 2697377Family a.9.1.0: automated matches [191674] (1 protein)
    not a true family
  6. 2697378Protein automated matches [191291] (5 species)
    not a true protein
  7. 2697393Species Pyrobaculum aerophilum [TaxId:13773] [267763] (2 PDB entries)
  8. 2697395Domain d1w4ka_: 1w4k A: [264190]
    automated match to d4qoye_

Details for d1w4ka_

PDB Entry: 1w4k (more details)

PDB Description: Peripheral-subunit binding domains from mesophilic, thermophilic, and hyperthermophilic bacteria fold by ultrafast, apparently two-state transitions
PDB Compounds: (A:) pyruvate dehydrogenase e2

SCOPe Domain Sequences for d1w4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4ka_ a.9.1.0 (A:) automated matches {Pyrobaculum aerophilum [TaxId: 13773]}
gsrevaampaarrlakelgidaskvkgtgpggvitvedvkrwaeetakata

SCOPe Domain Coordinates for d1w4ka_:

Click to download the PDB-style file with coordinates for d1w4ka_.
(The format of our PDB-style files is described here.)

Timeline for d1w4ka_: