SCOP 1.57: Domain d1bt7__: 1bt7 -

Lineage for d1bt7__ (1bt7 -)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (2 proteins)

6. Protein NS3 protease [50600] (2 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)

8. Domain d1bt7__: 1bt7 - [26418]

Details for d1bt7__

PDB Entry: 1bt7

PDB Description: the solution nmr structure of the n-terminal protease domain of the hepatitis c virus (hcv) ns3-protein, from bk strain, 20 structures

SCOP Domain Sequences for d1bt7__:

Sequence; same for both SEQRES and ATOM records:

>d1bt7__ b.47.1.3 (-) NS3 protease {Human hepatitis C virus (HCV), different isolates}
tgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkgpitqmytnvdqd
lvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpvsylkgssgg
pllcpsghavgifraavctrgvakavdfvpvesmettmraskkkk

Timeline for d1bt7__:

• d1bt7__ first appeared (with stable ids) in SCOP 1.55
  
• d1bt7__ appears in SCOP 1.59
  
• d1bt7__ appears in the current release, SCOPe 2.08, called d1bt7a1