Lineage for d1a1qc_ (1a1q C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066379Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2066380Protein NS3 protease [50600] (5 species)
  7. 2066390Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries)
    Uniprot P27958 1027-1206,1678-1669
    Uniprot P26662 1029-1202,1677-1689
    Uniprot O36579 1054-1207
  8. 2066411Domain d1a1qc_: 1a1q C: [26416]
    complexed with zn

Details for d1a1qc_

PDB Entry: 1a1q (more details), 2.4 Å

PDB Description: hepatitis c virus ns3 proteinase
PDB Compounds: (C:) ns3 proteinase

SCOPe Domain Sequences for d1a1qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1qc_ b.47.1.3 (C:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgags
ktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgd
srgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm

SCOPe Domain Coordinates for d1a1qc_:

Click to download the PDB-style file with coordinates for d1a1qc_.
(The format of our PDB-style files is described here.)

Timeline for d1a1qc_: