SCOPe 2.08: Domain d1u6ta1: 1u6t A:1-113

Lineage for d1u6ta1 (1u6t A:1-113)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d1u6ta1: 1u6t A:1-113 [264152]
   Other proteins in same PDB: d1u6ta2
   automated match to d1wrya_
   complexed with cit

Details for d1u6ta1

PDB Entry: 1u6t, 1.9 Å

PDB Description: Crystal structure of the human SH3 binding glutamic-rich protein like

PDB Compounds: (A:) SH3 domain-binding glutamic acid-rich-like protein

SCOPe Domain Sequences for d1u6ta1:

Sequence; same for both SEQRES and ATOM records:

>d1u6ta1 c.47.1.0 (A:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
virvyiasssgstaikkkqqdvlgfleankigfeekdiaaneenrkwmrenvpensrpat
gyplppqifnesqyrgdydaffearennavyaflgltappgskeaevqakqqa

Timeline for d1u6ta1:

• d1u6ta1 first appeared in SCOPe 2.05, called d1u6ta_
  
• d1u6ta1 appears in SCOPe 2.07