Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (10 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (6 PDB entries) |
Domain d1u3oa_: 1u3o A: [264151] automated match to d2egaa_ |
PDB Entry: 1u3o (more details)
SCOPe Domain Sequences for d1u3oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3oa_ b.34.2.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} sggceltvvlqdfsaahsselsiqvgqtvellerpserpgwclvrttersppqeglvpss tlcishs
Timeline for d1u3oa_: