SCOPe 2.05: Domain d1t3ga_: 1t3g A:

Lineage for d1t3ga_ (1t3g A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families)

5. Family c.23.2.0: automated matches [196997] (1 protein)
   not a true family

6. Protein automated matches [196998] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196999] (5 PDB entries)

8. Domain d1t3ga_: 1t3g A: [264149]
   automated match to d4om7a_

Details for d1t3ga_

PDB Entry: 1t3g, 2.3 Å

PDB Description: Crystal structure of the Toll/interleukin-1 receptor (TIR) domain of human IL-1RAPL

PDB Compounds: (A:) X-linked interleukin-1 receptor accessory protein-like 1

SCOPe Domain Sequences for d1t3ga_:

Sequence, based on SEQRES records:

>d1t3ga_ c.23.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kdydaylsytkvdpdqwnqetgeeerfaleilpdmlekhygyklfipdrdliptgtyied
varcvdqskrliivmtpnyvvrrgwsifeletrlrnmlvtgeikviliecselrgimnyq
evealkhtiklltvikwhgpkcnklnskfwkrlqyempf

Sequence, based on observed residues (ATOM records):

>d1t3ga_ c.23.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kdydaylsytkvdtgeeerfaleilpdmlekhygyklfipdrdliptgtyiedvarcvdq
skrliivmtpnyvvrrgwsifeletrlrnmlvtgeikviliecselrgimnyqevealkh
tiklltvikwhgpkcnklnskfwkrlqyempf

Timeline for d1t3ga_:

• d1t3ga_ is new in SCOPe 2.05-stable
  
• d1t3ga_ appears in SCOPe 2.06
  
• d1t3ga_ appears in the current release, SCOPe 2.08