SCOPe 2.05: Domain d4x00d_: 4x00 D:

Lineage for d4x00d_ (4x00 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (71 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [261487] (1 PDB entry)

8. Domain d4x00d_: 4x00 D: [264148]
   automated match to d4x00a_
   complexed with edo, f, gol

Details for d4x00d_

PDB Entry: 4x00, 1.38 Å

PDB Description: x-ray crystal structure of a putative aryl esterase from burkholderia cenocepacia

PDB Compounds: (D:) Putative hydrolase

SCOPe Domain Sequences for d4x00d_:

Sequence; same for both SEQRES and ATOM records:

>d4x00d_ c.69.1.0 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
rdytvtapdgvvlavqeagdpegspiifihgllgsrlnwskqlqdprlqhyrlitydlrg
hglsgkpaeassytdgrrwaddlaaiiestharkpvlvgwslggavisnylaaygdkgia
gavyvdgvielkpdqivahpevyrdmiasdlqthldgeraflrlcfhrqpdattfsllla
naalaswdmqravrsmtveaakglskaevpllllygaqdalvkakpsiarakslnprirs
elyadsghapfleeperfnrdlsdfvrmalsr

Timeline for d4x00d_:

• d4x00d_ is new in SCOPe 2.05-stable
  
• d4x00d_ appears in SCOPe 2.06
  
• d4x00d_ appears in the current release, SCOPe 2.08