Lineage for d4x00b_ (4x00 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152816Species Burkholderia cenocepacia [TaxId:216591] [261487] (1 PDB entry)
  8. 2152818Domain d4x00b_: 4x00 B: [264146]
    automated match to d4x00a_
    complexed with edo, f, gol

Details for d4x00b_

PDB Entry: 4x00 (more details), 1.38 Å

PDB Description: x-ray crystal structure of a putative aryl esterase from burkholderia cenocepacia
PDB Compounds: (B:) Putative hydrolase

SCOPe Domain Sequences for d4x00b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x00b_ c.69.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
rdytvtapdgvvlavqeagdpegspiifihgllgsrlnwskqlqdprlqhyrlitydlrg
hglsgkpaeassytdgrrwaddlaaiiestharkpvlvgwslggavisnylaaygdkgia
gavyvdgvielkpdqivahpevyrdmiasdlqthldgeraflrlcfhrqpdattfsllla
naalaswdmqravrsmtveaakglskaevpllllygaqdalvkakpsiarakslnprirs
elyadsghapfleeperfnrdlsdfvrmalsr

SCOPe Domain Coordinates for d4x00b_:

Click to download the PDB-style file with coordinates for d4x00b_.
(The format of our PDB-style files is described here.)

Timeline for d4x00b_: