Lineage for d4wshb_ (4wsh B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089841Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2089842Family c.1.22.1: Uroporphyrinogen decarboxylase, UROD [51727] (2 protein domains)
    automatically mapped to Pfam PF01208
  6. 2089868Protein automated matches [195370] (3 species)
    not a true protein
  7. 2089874Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [261186] (1 PDB entry)
  8. 2089876Domain d4wshb_: 4wsh B: [264140]
    automated match to d4wsha_
    complexed with cl, so4

Details for d4wshb_

PDB Entry: 4wsh (more details), 1.95 Å

PDB Description: crystal structure of probable uroporphyrinogen decarboxylase (upd) (uro-d) from pseudomonas aeruginosa
PDB Compounds: (B:) Uroporphyrinogen decarboxylase

SCOPe Domain Sequences for d4wshb_:

Sequence, based on SEQRES records: (download)

>d4wshb_ c.1.22.1 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
alkndrflrallkqpvdvtpvwmmrqagrylpeyratrakagdfmslcmnpelacevtlq
pldrypqldaailfsdiltipdamgqglyfetgegprfrkvvssladiealpvpdpeqdl
gyvmdavrtirrelngrvpligfsgspwtlatymveggsskdfrkskamlydnpkamhal
ldklaqsvtsylngqihagaqavqifdswggslsaaayqefslaymrkivdglirehdgr
rvpvilftkggglwlesmaevgaealgldwtcdigsararvgervalqgnmdpsvlyanp
aairaevarilaaygkgtghvfnlghgitpevdpahagaffeavhelsaqyhg

Sequence, based on observed residues (ATOM records): (download)

>d4wshb_ c.1.22.1 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
alkndrflrallkqpvdvtpvwmmrqagrylpeyratrakagdfmslcmnpelacevtlq
pldrypqldaailfsdiltipdamgqglyprfrkvvssladiealpvpdpeqdlgyvmda
vrtirrelngrvpligfsgspwtlatymveggsskdfrkskamlydnpkamhalldklaq
svtsylngqihagaqavqifdswggslsaaayqefslaymrkivdglirehdgrrvpvil
ftkggglwlesmaevgaealgldwtcdigsararvgervalqgnmdpsvlyanpaairae
varilaaygkgtghvfnlghgitpevdpahagaffeavhelsaqyhg

SCOPe Domain Coordinates for d4wshb_:

Click to download the PDB-style file with coordinates for d4wshb_.
(The format of our PDB-style files is described here.)

Timeline for d4wshb_: