SCOPe 2.06: Domain d1a1qa_: 1a1q A:

Lineage for d1a1qa_ (1a1q A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (5 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries)
   Uniprot P27958 1027-1206,1678-1669
   Uniprot P26662 1029-1202,1677-1689
   Uniprot O36579 1054-1207

8. Domain d1a1qa_: 1a1q A: [26414]
   complexed with zn

Details for d1a1qa_

PDB Entry: 1a1q, 2.4 Å

PDB Description: hepatitis c virus ns3 proteinase

PDB Compounds: (A:) ns3 proteinase

SCOPe Domain Sequences for d1a1qa_:

Sequence; same for both SEQRES and ATOM records:

>d1a1qa_ b.47.1.3 (A:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgags
ktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgd
srgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmrs
pvf

Timeline for d1a1qa_:

• d1a1qa_ first appeared (with stable ids) in SCOP 1.55
  
• d1a1qa_ appears in SCOPe 2.05
  
• d1a1qa_ appears in SCOPe 2.07
  
• d1a1qa_ appears in the current release, SCOPe 2.08