Lineage for d4wp0c_ (4wp0 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131336Protein automated matches [190317] (5 species)
    not a true protein
  7. 2131360Species Human (Homo sapiens) [TaxId:9606] [188901] (8 PDB entries)
  8. 2131373Domain d4wp0c_: 4wp0 C: [264135]
    Other proteins in same PDB: d4wp0a2, d4wp0b2, d4wp0d2
    automated match to d4wp0a_

Details for d4wp0c_

PDB Entry: 4wp0 (more details), 3 Å

PDB Description: crystal structure of human kynurenine aminotransferase-i with a c- terminal v5-hexahistidine tag
PDB Compounds: (C:) Kynurenine--oxoglutarate transaminase 1

SCOPe Domain Sequences for d4wp0c_:

Sequence, based on SEQRES records: (download)

>d4wp0c_ c.67.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfmlnqy
tktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdeviiiep
ffdcyepmtmmaggrpvfvslkpgpiqngelgsssnwqldpmelagkftsrtkalvlntp
nnplgkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertltig
sagktfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfrqps
syfvqfpqamqrcrdhmirslqsvglkpiipqgsyflitdisdfkrkmpdlpgavdepyd
rrfvkwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkvel

Sequence, based on observed residues (ATOM records): (download)

>d4wp0c_ c.67.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlqarrldgidynpwvefvklasehdvvnlgqgfpdfpppdfaveafqhavsgdfmlnqy
tktfgyppltkilasffgellgqeidplrnvlvtvggygalftafqalvdegdeviiiep
ffdcyepmtmmaggrpvfvslkpgpilgsssnwqldpmelagkftsrtkalvlntpnnpl
gkvfsreelelvaslcqqhdvvcitdevyqwmvydghqhisiaslpgmwertltigsagk
tfsatgwkvgwvlgpdhimkhlrtvhqnsvfhcptqsqaavaesfereqllfrqpssyfv
qfpqamqrcrdhmirslqsvglkpiipqgsyflitdisdfkrkmpdlpgavdepydrrfv
kwmiknkglvaipvsifysvphqkhfdhyirfcfvkdeatlqamdeklrkwkvel

SCOPe Domain Coordinates for d4wp0c_:

Click to download the PDB-style file with coordinates for d4wp0c_.
(The format of our PDB-style files is described here.)

Timeline for d4wp0c_: